IL17_MOUSE Q62386
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62386
Recommended name:Interleukin-17A
EC number:
Alternative names:(IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)
Cleaved into:
GeneID:16171
Gene names (primary ):Il17a
Gene names (synonym ):Ctla8 Il17
Gene names (ORF ):
Length:158
Mass:17490
Sequence:MSPGRASSVSLMLLLLLSLAATVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Tissue specificity:Expressed by Th17 cell lineage (at protein level). The expression pattern reflects the differentiation state, with IL17A-IL17F heterodimers produced at higher levels than IL17A-IL17A and IL17F-IL17F dimers in fully differentiated Th17 cells (PubMed:18025225, PubMed:16990136). Expressed in innate lymphoid cells (at protein level) (PubMed:23255360, PubMed:28709803). Expressed in gamma-delta T cell subsets (at protein level) (PubMed:17372004, PubMed:20364087, PubMed:28709803, PubMed:26431948). Expressed in iNKT cells (at protein level) (PubMed:17470641). {ECO:0000269|PubMed:16990136, ECO:0000269|PubMed:17372004, ECO:0000269|PubMed:17470641, ECO:0000269|PubMed:18025225, ECO:0000269|PubMed:20364087, ECO:0000269|PubMed:23255360, ECO:0000269|PubMed:26431948, ECO:0000269|PubMed:28709803}.
Induction:Induced upon differentiation of CD4-positive T cells toward Th17 effector cells upon antigen receptor binding in the presence of IL6 and TGFB1 (PubMed:16200068, PubMed:16990136, PubMed:18025225). Up-regulated by IL23A-IL12B, IL1B and TNF and inhibited by IFNG and IL4 (PubMed:16200068, PubMed:18025225). Up-regulated by proinflammatory cytokines in response to microbes in various immune cells: induced in innate lymphoid cells upon fungal infection, in Vdelta4-positive gamma-delta T cells upon C. mastitidis infection, in Vdelta5-positive gamma-delta T cells upon S. aureus infection and in Vdelta1-positive gamma-delta T cells upon E. coli infection (PubMed:23255360, PubMed:28709803, PubMed:20364087, PubMed:17372004). Induced in gamma-delta T cells in intestinal lamina propria upon acute injury (PubMed:26431948). Induced in KLRB1/NK1.1-negative iNKT cell subset upon CD1D stimulation (PubMed:17470641). {ECO:0000269|PubMed:16200068, ECO:0000269|PubMed:16990136, ECO:0000269|PubMed:17372004, ECO:0000269|PubMed:17470641, ECO:0000269|PubMed:18025225, ECO:0000269|PubMed:20364087, ECO:0000269|PubMed:23255360, ECO:0000269|PubMed:26431948, ECO:0000269|PubMed:28709803}.
Developmental stage:
Protein families:IL-17 family