PCNP_RAT   Q7TP40


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TP40

Recommended name:PEST proteolytic signal-containing nuclear protein

EC number:

Alternative names:Liver regeneration-related protein LRRG084

Cleaved into:

GeneID:288165

Gene names  (primary ):Pcnp

Gene names  (synonym ):Ab2-416

Gene names  (ORF ):

Length:189

Mass:20,195

Sequence:MGASCTATQSQFLLYTLTSSEETVGSVGDSCRGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEDEAADLPTKPTKMSKFGFAIGSQTARKASAISIRLGASKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp