NDRG2_MOUSE Q9QYG0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QYG0
Recommended name：Protein NDRG2
EC number：
Alternative names：(N-myc downstream-regulated gene 2 protein) (Protein Ndr2)
Cleaved into：
GeneID：29811
Gene names (primary )：Ndrg2
Gene names (synonym )：Kiaa1248 Ndr2
Gene names (ORF )：
Length：371
Mass：40789
Sequence：MAELQEVQITEEKPLLPGQTPETAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPDMILGHLFSQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASIDGSRSRSRTLSQSSESGTLPSGPPGHTMEVSC
Tissue specificity：Expressed at highest levels in brain, heart and liver, and at lower levels in kidney, colon, skeletal muscle, adrenal gland, ovary and uterus (at protein level). {ECO:0000269|PubMed:15461589, ECO:0000269|PubMed:16520977, ECO:0000269|PubMed:21636852}.
Induction：
Developmental stage：Expression is restricted to the developing heart at the stage of 9.5 dpc, and increases after 11.5 dpc as development of tissues and organs proceeds. Present in many developing tissues including heart, brain, lung, liver, gut, kidney, skeletal muscle, cartilage and epidermis (at protein level). {ECO:0000269|PubMed:15207261, ECO:0000269|PubMed:16520977}.
Protein families：NDRG family