RAI3_MOUSE Q8BHL4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BHL4
Recommended name：Retinoic acid-induced protein 3
EC number：
Alternative names：(G-protein coupled receptor family C group 5 member A) (Retinoic acid-induced gene 1 protein) (RAIG-1)
Cleaved into：
GeneID：
Gene names (primary )：Gprc5a
Gene names (synonym )：Rai3 Raig1
Gene names (ORF )：
Length：356
Mass：40101
Sequence：MTTPTTAPSGCRSDLDSRYHRLCDLAEGWGIALETLAAVGAVATVACMFALVFLICKVQDSNKRKMLPAQFLFLLGVLGVFGLTFAFIIKLDGATGPTRFFLFGVLFAICFSCLLAHAFNLIKLVRGRKPLSWLVILSLAVGFSLVQDVIAIEYLVLTMNRTNVNVFSELPAPRRNEDFVMLLIYVLVLMVLTFFTSFLVFCGSFSGWKRHGFHICFTSFLSIAIWVAWIVLLLIPDIDRKWDDTILSTALVANGWVFLAFYILPEFRQLPRQRSPTDYPVEDAFCKPQLMKQSYGVENRAYSQEEITQGLEMGDTLYAPYSTHFQLQNHQKDFSIPRAQAPASPYNDYEGRKGDS
Tissue specificity：Expressed predominantly in normal fetal and adult lung. Almost undetectable or expressed at very low levels in other tissues. {ECO:0000269|PubMed:18000218}.
Induction：By all-trans retinoic acid (ATRA). {ECO:0000269|PubMed:14706456}.
Developmental stage：
Protein families：G-protein coupled receptor 3 family