CCNH_MOUSE   Q61458


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61458

Recommended name:Cyclin-H

EC number:

Alternative names:

Cleaved into:

GeneID:66671

Gene names  (primary ):Ccnh

Gene names  (synonym ):

Gene names  (ORF ):

Length:323

Mass:37506

Sequence:MYHSSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEELTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQERALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYEDDDYVSKKPKQEEEEWTDDDLVDSL

Tissue specificity:Expressed in both the germinal and somatic cells of the testis.

Induction:

Developmental stage:Higher expression during spermatogenesis from the mitotic stages to the meiotic stages.

Protein families:Cyclin family, Cyclin C subfamily


   💬 WhatsApp