SRSF3_MOUSE P84104
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P84104
Recommended name：Serine/arginine-rich splicing factor 3
EC number：
Alternative names：(Pre-mRNA-splicing factor SRP20) (Protein X16) (Splicing factor, arginine/serine-rich 3)
Cleaved into：
GeneID：20383
Gene names (primary )：Srsf3
Gene names (synonym )：Sfrs3 Srp20 X16
Gene names (ORF )：
Length：164
Mass：19330
Sequence：MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
Tissue specificity：Highest expression in thymus and pre-B cell lines; high, in testis, brain and spleen; very low in heart and not detectable in liver and kidney. {ECO:0000269|PubMed:2030943}.
Induction：Isoform long is induced by serum; in a tissue culture. {ECO:0000269|PubMed:2030943}.
Developmental stage：
Protein families：Splicing factor SR family