NRAC_MOUSE   Q8BNX7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BNX7

Recommended name:Nutritionally-regulated adipose and cardiac-enriched protein

EC number:

Alternative names:

Cleaved into:

GeneID:319942

Gene names  (primary ):Nrac

Gene names  (synonym ):

Gene names  (ORF ):

Length:165

Mass:18347

Sequence:MRSAARVSRSNSHPRTRHPTRENEGTTWGSQPSRTERDGDRKCPPSILRPRRQECGCHGGEPQKTSRHVRFREPLEVAVHYIARKDTTAAIKVPSRPASHGGSPLQPASCSGSLFLWLTLCALLGVVLVLYCGQAKRVTAALEDLLAQLLALILRLWRVVLACWH

Tissue specificity:Predominantly expressed in white adipose tissue (at protein level) and brown adipose tissue. Also detected in heart. {ECO:0000269|PubMed:23029450}.

Induction:Highly up-regulated during 3T3-L1 cell differentiation into adipocytes. In vivo, down-regulated by fasting in both white and brown adipose tissues. Reduced in white adipose tissue in obese animals. {ECO:0000269|PubMed:23029450}.

Developmental stage:

Protein families:


   💬 WhatsApp