KREM2_MOUSE   Q8K1S7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K1S7

Recommended name:Kremen protein 2

EC number:

Alternative names:(Dickkopf receptor 2) (Kringle domain-containing transmembrane protein 2) (Kringle-containing protein marking the eye and the nose)

Cleaved into:

GeneID:73016

Gene names  (primary ):Kremen2

Gene names  (synonym ):

Gene names  (ORF ):

Length:461

Mass:49170

Sequence:MGTPHLQGFLLLFPLLLRLHGASAGSLHSPGLSECFQVNGADYRGHQNYTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWSAPQGVIYSPDFPDEYGPDRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDVSSGNLLRAFDGAHPPPPGPLRLRTAALLLTFRSDARGHAQGFALTYRGLQDTVEGRASPEDSTESLAGDPDGANASCSPKPGAAQASIGARVFSTVTAFSVLLLLLLSLLRLLRRRSCLLAPGKGSLAMGPSRGPGRSWAVWYRRPRGVALPCPPGDSQAEGPAAGYRPLSASSQSSLRSLVSAL

Tissue specificity:

Induction:

Developmental stage:Expressed in the developing brain and developing limb buds. {ECO:0000269|PubMed:26206087}.

Protein families:


   💬 WhatsApp