H17B6_MOUSE Q9R092
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R092
Recommended name:17-beta-hydroxysteroid dehydrogenase type 6
EC number:EC 1.1.1.105
Alternative names:(17-beta-HSD 6) (17-beta-HSD6) (17-beta-HSD9) (3-alpha->beta-hydroxysteroid epimerase) (3-alpha->beta-HSE) (Oxidative 3-alpha hydroxysteroid dehydrogenase)
Cleaved into:
GeneID:27400
Gene names (primary ):Hsd17b6
Gene names (synonym ):Gm182 Hsd17b9 Rdh8
Gene names (ORF ):
Length:317
Mass:36103
Sequence:MWFYLVTLVGLYHLLRWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGDRGLWGLVNNAGVLQPFAYIEWYRPEDYMPIFQVNLIGLTQVTISMLFLVKKARGRIVNVSSALGRVALFGGFYSCSKYGVEAFSDVLRHEVQDFGVKVSIIEPGSFKTEMTDAELTIERTKKVWEAAPEHIKESYGQQFFDDFCSTTKRELMKCSRNLSLVTDCMEHALTSTHPRTRYSAGWDAKFFFIPLSYLPASLVDYLLAISRGKPAQAA
Tissue specificity:Detected in liver. {ECO:0000269|PubMed:10537158}.
Induction:
Developmental stage:
Protein families:Short-chain dehydrogenases/reductases (SDR) family