LIN7A_RAT Q9Z250
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z250
Recommended name：Protein lin-7 homolog A
EC number：
Alternative names：Mammalian lin-seven protein 1 (MALS-1) Vertebrate lin-7 homolog 1 (Veli-1)
Cleaved into：
GeneID：
Gene names (primary )：Lin7a
Gene names (synonym )：Mals1, Veli1
Gene names (ORF )：
Length：232
Mass：25,865
Sequence：MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQPQQNHMS
Tissue specificity：Ubiquitously expressed in brain and detected in lung, liver and testis (at protein level). Expression was detected only in brain. 4 s
Induction：Detected only after the second postnatal week. 1 Publication
Developmental stage：Up-regulated by cell depolarization and calcium entry through L-type calcium channels. 1
Protein families：