CLC9A_RAT   D4AD02


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D4AD02

Recommended name:C-type lectin domain family 9 member A

EC number:

Alternative names:

Cleaved into:

GeneID:502901

Gene names  (primary ):Clec9a

Gene names  (synonym ):

Gene names  (ORF ):

Length:241

Mass:27,429

Sequence:MHEEEIYTSLQWDIPTSEASQKCPSLSKCPGTWCIVTVISCVVCVGLLAASIFLGIKFSQVSSLVMEQRERLIRQDTALLNLTEWQRNHTLQLKSCQASLQRSLRSGSNCNPCPPNWIQNGKSCYYAFDRWETWNNSKKSCLKEGDSLLQIDSKEEMEFINLSIWKLKGGYEYWVGVFQDGPSGSWFWEDGSSPLSDLLPTDRQLSASQICGYLKDHTLISDNCSNWKYFICEKKAFGSCI

Tissue specificity:High expression in the spleen, moderate to low levels in several other tissues and cell types, but no detectable expression in skin dendritic cells or CD4+ T-cells. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp