K1B21_MOUSE Q61759
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61759
Recommended name：Kallikrein 1-related peptidase b21
EC number：EC 3.4.21.35
Alternative names：(Glandular kallikrein K21) (mGK-21) (Tissue kallikrein 21)
Cleaved into：
GeneID：16616
Gene names (primary )：Klk1b21
Gene names (synonym )：Klk-21 Klk21
Gene names (ORF )：
Length：261
Mass：28690
Sequence：MRFLILFLALSLGEIDAAPPVQSRIVGGFNCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCYGNQYNVWLGKNKLFQHESSAQHRLVSKSFPHPDYNMSLMNDHTPHPEDDYSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKWQIPNDLQCGFIKPLPNENCAKAYIHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGVLQGITSWGSIPCAKPNAPAIYTKLIKFTSWIKDTMAKNP
Tissue specificity：Expressed in testis and submaxillary gland. In the testis, expression localized specifically to Leydig cells in the interstitial tissues. {ECO:0000269|PubMed:11606460}.
Induction：By T protein. {ECO:0000269|PubMed:11606460}.
Developmental stage：Detectable in testis 4 weeks after birth, becoming more prominent thereafter. {ECO:0000269|PubMed:11606460}.
Protein families：Peptidase S1 family, Kallikrein subfamily