NRK2_MOUSE   Q9D7C9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D7C9

Recommended name:Nicotinamide riboside kinase 2

EC number:EC 2.7.1.22

Alternative names:(NRK 2) (NmR-K 2) (Integrin beta-1-binding protein 3) (Muscle integrin-binding protein) (MIBP) (Nicotinic acid riboside kinase 2) (Ribosylnicotinamide kinase 2) (RNK 2) (Ribosylnicotinic acid kinase 2)

Cleaved into:

GeneID:69564

Gene names  (primary ):Nmrk2

Gene names  (synonym ):Itgb1bp3 Nrk2

Gene names  (ORF ):

Length:195

Mass:22375

Sequence:MKLIIGIGGVTNGGKTTLTNSLLKALPNCCVIHQDDFFKPQDQIAVGEDGFKQWDVLESLDMETMLSTVQAWVKDPHKFARAHGVSLQSGASDTHVLLLEGFLLYSYRPLVDLYSQRYFLTVPYEECKRRRRSRTYMVPDPPGLFDGHVWPMYQKYRREMEQDGVEVVYLDGMKSPEGLFHQVLEDIQNRLLNTS

Tissue specificity:Expressed in skeletal muscle (at protein level). {ECO:0000269|PubMed:10613898}.

Induction:Down-regulated during myoblast differentiation. {ECO:0000269|PubMed:10613898}.

Developmental stage:

Protein families:Uridine kinase family, NRK subfamily


   💬 WhatsApp