GLMP_MOUSE   Q9JHJ3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHJ3

Recommended name:Glycosylated lysosomal membrane protein

EC number:

Alternative names:(Lysosomal protein NCU-G1)

Cleaved into:

GeneID:56700

Gene names  (primary ):Glmp

Gene names  (synonym ):

Gene names  (ORF ):

Length:404

Mass:43804

Sequence:MFRCWGPHWGWVPCAPTPWLLLSLLVCSAPFGLQGEETRQVSMEVISGWPNPQNLLHIRAVGSNSTLHYVWSSLGPPAVVLVATNTTQSVLSVNWSLLLSPDPAGALMVLPKSSIQFSSALVFTRLLEFDSTNASEGAQPPGKPYPPYSLAKFSWNNITNSLDLANLSADFQGRPVDDPTGAFANGSLTFKVQAFSRSGRPAQPPRLLHTADVCQLEVALVGASPRGNHSLFGLEVATLGQGPDCPSVNERNSIDDEYAPAVFQLNQLLWGSSPSGFMQWRPVAFSEEERARESALPCQASTLHSTLASSLPHSPIVQAFFGSQNNFCAFNLTFGAPTGPGYWDQYYLCWSMLLGMGFPPVDIFSPLVLGIMAVALGAPGLMFLGGGLFLLLRHRRYSEYQSIN

Tissue specificity:Detected in brain, heart, liver, kidney, lung, intestine, testis and spleen (PubMed:11444019, PubMed:19489740, PubMed:24487409). Expressed at highest levels in kidney cortex (PubMed:11444019, PubMed:19489740). However, another study reports highest expression levels in lung (PubMed:24487409). {ECO:0000269|PubMed:11444019, ECO:0000269|PubMed:19489740, ECO:0000269|PubMed:24487409}.

Induction:

Developmental stage:Expressed at all stages of development tested. {ECO:0000269|PubMed:11444019}.

Protein families:GLMP family


   💬 WhatsApp