NUBP2_MOUSE   Q9R061


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R061

Recommended name:Cytosolic Fe-S cluster assembly factor NUBP2

EC number:

Alternative names:(Nucleotide-binding protein 2) (NBP 2)

Cleaved into:

GeneID:26426

Gene names  (primary ):Nubp2

Gene names  (synonym ):

Gene names  (ORF ):

Length:275

Mass:29518

Sequence:MEAAAGERAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHMLRAQGKAVHQCDNGWVPVFVDQEQSISLMSVGFLLENPDEAVVWRGPKKHALIKQFVSDVAWGQLDYLVVDTPPGTSDEHMATMEALRPYRPLGALVVTTPQAVSIGDVRRELTFCKKTGLQVIGVIENMSGFTCPHCAECTNVFSSGSGEELARLAGVPFLGSVPLDSQLTRSLEEGRDFIQEFPKSTAYSALTSIAQRVVHRMSALCS

Tissue specificity:Widely expressed.

Induction:

Developmental stage:Expressed at 7, 11, 15 and 17 dpc.

Protein families:Mrp/NBP35 ATP-binding proteins family, NUBP2/CFD1 subfamily


   💬 WhatsApp