OXGR1_MOUSE Q6IYF8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6IYF8
Recommended name：2-oxoglutarate receptor 1
EC number：
Alternative names：(Alpha-ketoglutarate receptor 1) (G-protein coupled receptor 99)
Cleaved into：
GeneID：239283
Gene names (primary )：Oxgr1
Gene names (synonym )：Gpr99
Gene names (ORF )：
Length：337
Mass：38230
Sequence：MIEPLDSPASDSDFLDYPSALGNCTDEQISFKMQYLPVIYSIIFLVGFPGNTVAISIYIFKMRPWRGSTVIMLNLALTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFGFHFNLYSSILFLTCFSLFRYVVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPMTFLITSTTRTNRSACLDLTSSDDLTTIKWYNLILTATTFCLPLVIVTLCYTTIISTLTHGPRTHSCFKQKARRLTILLLLVFYICFLPFHILRVIRIESRLLSISCSIESHIHEAYIVSRPLAALNTFGNLLLYVVVSNNFQQAFCSIVRCKASGDLEQGKKDSCSNNP
Tissue specificity：Predominantly expressed in the kidney with limited expression in the testis and the smooth muscle. {ECO:0000269|PubMed:15141213}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family