ATP5I_RAT P29419
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P29419
Recommended name：ATP synthase F(0) complex subunit e, mitochondrial Curated
EC number：
Alternative names：ATP synthase membrane subunit e Curated
Cleaved into：
GeneID：140608
Gene names (primary )：Atp5me
Gene names (synonym )：Atp5i
Gene names (ORF )：
Length：71
Mass：8,255
Sequence：MVPPVQVSPLIKFGRYSALILGMAYGAKRYSYLKPRAEEERRIAAEEKKRLDELKRIERELAEAEDVSIFK
Tissue specificity：
Induction：
Developmental stage：
Protein families：