IR3IP_RAT P85007
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P85007
Recommended name:Immediate early response 3-interacting protein 1 Curated
EC number:
Alternative names:
Cleaved into:
GeneID:127566412
Gene names (primary ):Ier3ip1
Gene names (synonym ):
Gene names (ORF ):
Length:82
Mass:8,999
Sequence:MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIRSVRTVMRVPLIIVNSITIVLLLLFG
Tissue specificity:
Induction:
Developmental stage:
Protein families: