IR3IP_RAT   P85007


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P85007

Recommended name:Immediate early response 3-interacting protein 1 Curated

EC number:

Alternative names:

Cleaved into:

GeneID:127566412

Gene names  (primary ):Ier3ip1

Gene names  (synonym ):

Gene names  (ORF ):

Length:82

Mass:8,999

Sequence:MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIRSVRTVMRVPLIIVNSITIVLLLLFG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp