ATIF1_RAT Q03344
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q03344
Recommended name:ATPase inhibitor, mitochondrial Curated
EC number:
Alternative names:
Cleaved into:
GeneID:25392
Gene names (primary ):Atp5if1
Gene names (synonym ):Atpi, Atpif1, If1
Gene names (ORF ):
Length:107
Mass:12,248
Sequence:MAGSALAVRARLGVWGMRVLQTRGFGSDSSESMDSGAGSIREAGGAFGKREKAEEDRYFREKTREQLAALKKHHEDEIDHHSKEIERLQKQIERHKKKIKYLKNSEH
Tissue specificity:
Induction:
Developmental stage:
Protein families:ATPase inhibitor family