I17RD_MOUSE Q8JZL1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8JZL1
Recommended name：Interleukin-17 receptor D
EC number：
Alternative names：(IL-17 receptor D) (IL-17RD) (Interleukin-17 receptor-like protein) (Sef homolog) (mSef)
Cleaved into：
GeneID：171463
Gene names (primary )：Il17rd
Gene names (synonym )：Il17rlm Sef
Gene names (ORF )：
Length：738
Mass：82348
Sequence：MAPWLQLCSFFFTVNACLNGSQLAVAAGGSGRARGADTCGWRGVGPASRNSGLHNITFRYDNCTTYLNPGGKHAIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFRRTGMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMHVSFDHAPQNFGFRGFHVLYKLKHEGPFRRRTCRQDQNTETTSCLLQNVSPGDYIIELVDDSNTTRKAAQYVVKSVQSPWAGPIRAVAITVPLVVISAFATLFTVMCRKKQQENIYSHLDEESPESSTYAAALPRDRLRPQPKVFLCYSNKDGQNHMNVVQCFAYFLQDFCGCEVALDLWEDFSLCREGQREWAIQKIHESQFIIVVCSKGMKYFVDKKNFRHKGGSRGEAQGEFFLVAVAAIAEKLRQAKQSSSAALRKFIAVYFDYSCEGDVPCSLDLSTKYKLMDHLPELCAHLHSGEQEVLGQHPGHSSRRNYFRSKSGRSLYVAICNMHQFIDEEPDWFEKQFIPFQHPPVRYQEPVLEKFDSGLVLNDVISKPGPESDFCRKVEACVLGAAGPADSYSYLESQHVGLDQDTEAQPSCDSAPALQPLLHAVKAGSPSEMPRDSGIYDSSVPSSELSLPLMEGLSPDQIETSSLTESVSSSSGLGEEDPPTLPSKLLASGVSREHGCHSHTDELQALAPL
Tissue specificity：
Induction：
Developmental stage：During early embryogenesis, predominantly expressed at 6.5 dpc and 9.5 dpc in the forebrain, mid-hindbrain boundary, branchial arches, somites, limb bud and tailbud. At 12.5 dpc additionally expressed in the diencephalon, optic stalk, pituitary, olfactory and oral epithelium, tooth primordia, somites, developing metanephric kidney and stomach. Expressed in the neopallial cortex, rhombic lip and dorsal regions of the myelencephalon and in the frontal nasal process. Expressed in the commissural plate and septal area of the forebrain and in the hippocampus, lens and optic cup. In the oral region, expressed in the tongue and in the mesenchyme of the first branchial arch. Also expressed in the developing inner ear. Expression patterns remain essentially unchanged at 15.5 dpc, with the addition of a strong expression in the submandibular gland. {ECO:0000269|PubMed:11960706}.
Protein families：