CP3AI_RAT Q64581
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64581
Recommended name：Cytochrome P450 3A18
EC number：EC:1.14.14.1
Alternative names：CYPIIIA18 Cytochrome P450(6)beta-2
Cleaved into：
GeneID：252931
Gene names (primary )：Cyp3a18
Gene names (synonym )：
Gene names (ORF )：
Length：497
Mass：57,307
Sequence：MEIIPNLSIETWVLLATSLMLFYIYGTYSHGLFKKLGIPGPKPVPLFGTIFNYGDGMWKFDDDCYKKYGKIWGFYEGPQPFLAIMDPEIIKMVLVKECYSVFTNRRCFGPMGFMKKAITMSEDEEWKRLRTILSPTFTSGKLKEMFPLMRQYGDTLLKNLRREEAKGEPINMKDIFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKILKFQIFDPFLLSVVLFPFLTPIYEMLNFSIFPRQSMNFFKKFVKTMKKNRLDSNQKNRVDFLQLMMNTQNSKGQESQKALSDLEMAAQAIIFIFGGYDATSTSISFIMYELATRPNVQKKLQNEIDRALPNKAPVTYDALMEMEYLDMVVNESLRLYPIATRLDRVSKKDVEINGVFIPKGTVVTIPIYPLHRNPEYWLEPEEFNPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALISMKLAVIGVLQNFNIQPCEKTQIPLKISRQPIFQPEGPIILKLVSRD
Tissue specificity：By pregnenolone-alpha-carbonitrile, dexamethasone, phenobarbital, and triacetyloleandomycin.
Induction：
Developmental stage：
Protein families：