PP2BA_RAT P63329
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63329
Recommended name：Protein phosphatase 3 catalytic subunit alpha Imported
EC number：EC:3.1.3.16
Alternative names：CAM-PRP catalytic subunit Calcineurin A alpha 1 Publication Calmodulin-dependent calcineurin A subunit alpha isoform By Similarity (CNA alpha By Similarity) Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform By Similarity
Cleaved into：
GeneID：
Gene names (primary )：Ppp3ca
Gene names (synonym )：Calna
Gene names (ORF )：
Length：521
Mass：58,644
Sequence：MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
Tissue specificity：Expressed in neonatal cardiomyocytes (at protein level) (PubMed:11114196). Expressed in hippocampal presynaptic termini (at protein level) (PubMed:23699505). 2 s
Induction：
Developmental stage：
Protein families：