AQP3_MOUSE   Q8R2N1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R2N1

Recommended name:Aquaporin-3

EC number:

Alternative names:(AQP-3) (Aquaglyceroporin-3)

Cleaved into:

GeneID:11828

Gene names  (primary ):Aqp3

Gene names  (synonym ):

Gene names  (ORF ):

Length:292

Mass:31568

Sequence:MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNELFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSTEEENVKLAHMKHKEQI

Tissue specificity:Detected in principal cells in collecting ducts in kidney medulla (at protein level) (PubMed:16641094). Renal medulla and colon. Predominantly in the inner medulla. Expressed in basal layer of epidermal keratinocytes. {ECO:0000269|PubMed:16641094}.

Induction:

Developmental stage:

Protein families:MIP/aquaporin (TC 1.A.8) family


   💬 WhatsApp