TRIQK_MOUSE   B2B9E1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B2B9E1

Recommended name:Triple QxxK/R motif-containing protein

EC number:

Alternative names:(Triple repetitive-sequence of QXXK/R protein homolog)

Cleaved into:

GeneID:208820

Gene names  (primary ):Triqk

Gene names  (synonym ):Gm11818

Gene names  (ORF ):

Length:86

Mass:9722

Sequence:MGRKDSSNTKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLMLAAILALLLAFYAFFYLRLSTNIDSDLDLDED

Tissue specificity:Expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis. {ECO:0000269|PubMed:18828657}.

Induction:

Developmental stage:Expressed in embryo from 7 to 17 dpc. {ECO:0000269|PubMed:18828657}.

Protein families:TRIQK family


   💬 WhatsApp