TWST2_MOUSE Q9D030
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D030
Recommended name：Twist-related protein 2
EC number：
Alternative names：(Dermis-expressed protein 1) (Dermo-1)
Cleaved into：
GeneID：13345
Gene names (primary )：Twist2
Gene names (synonym )：Dermo1
Gene names (ORF )：
Length：160
Mass：18140
Sequence：MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAYSVWRMEGAWSMSASH
Tissue specificity：Expressed at low levels in sclerotome and dermatome of somites, and in limb buds at 10.5 dpc. Accumulates predominantly in dermatome, prevertebrae and derivatives of branchial arches by 13 dpc. Also expressed near surface of embryo and in chondrogenic cells. In adult, expressed at low levels in skin, bladder, uterus, aorta and heart. {ECO:0000269|PubMed:7589808}.
Induction：By TNF-alpha. {ECO:0000269|PubMed:12553906}.
Developmental stage：In the embryo, expression is detected at 10.5 dpc, increases continuously through to 17.5 dpc and is also high in neonates. Down-regulated in adults. {ECO:0000269|PubMed:7589808}.
Protein families：