ST2A1_RAT   P15709


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P15709

Recommended name:Sulfotransferase 2A1

EC number:EC:2.8.2.2

Alternative names:ST2A1

Cleaved into:

GeneID:24912

Gene names  (primary ):Sult2a1

Gene names  (synonym ):St2a1

Gene names  (ORF ):

Length:284

Mass:33,135

Sequence:MPDYTWFEGIPFHAFGISKETLQNVCNKFVVKDEDLILLAYPKSGTNWLIEIVCLIQTKGDPKWIQSVTIWDRSPWIETDLGYDMLIKKKGPRLITSHLPMHLFSKSLFSSKAKVIYLVRNPRDVLVSGYYFWGNSTLAKKPDSLGTYVEWFLKGNVLYGSWFEHIRAWLSMREWDNFLLLYYEDMKKDTMGTIKKICDFLGKKLEPDELDLVLKYSSFQVMKENDMSNYSLLMKKSIFTGIGLMRKGTVGDWKNHFTVSQAEAFDKVFQEKMAGFPPGMFPWE

Tissue specificity:Induced by estrogens and suppressed by androgens. Expression is under the influence of pituitary growth hormone and thyroid hormone.

Induction:

Developmental stage:There is a marked sex difference (female >> male) in the expressed level of mRNA for this protein. 1

Protein families:


   💬 WhatsApp