CF015_MOUSE   Q8BM15


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BM15

Recommended name:Uncharacterized protein C6orf15 homolog

EC number:

Alternative names:(Extracellular matrix protein with prion homology) (Emprin) (Protein STG)

Cleaved into:

GeneID:69542

Gene names  (primary ):Stg

Gene names  (synonym ):

Gene names  (ORF ):

Length:349

Mass:36654

Sequence:MQSHAGGSRAPLGLLLICLCLPGLFARSTGAPEEKASPHSGQPSFTSLLNPGQPQPKPDPVNNELLGVLPRLSESPQDGALPEGGSEVPNGPPFWGPPPMESWPSEDPQQGMAAVAEDQLEQMLPEALPYLSRGGRLPEASSARLRQPSLAASYPQDSEAGLQPGSSSLETEAEAFARSPFWFLIHKLLPGSSGRILRPGTSWGSGGAGTGWGTRPMPYPSGIWGSNGLVSGTSLGGRGPYPVRIWGRNGWYPLRILGGNGRYPPVGTWGGYGQYPPVGTWGGYGQYPPVGPWGGYGQYPPVGTWGANCQYPAGSRRPNCRYPAGSWGTKGQNRLPPGAKRPGSSGITP

Tissue specificity:

Induction:

Developmental stage:At 16.5 dpc, present in rib cartilage (at protein level). {ECO:0000269|PubMed:18757743}.

Protein families:


   💬 WhatsApp