NAAA_RAT   Q5KTC7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5KTC7

Recommended name:N-acylethanolamine-hydrolyzing acid amidase Curated

EC number:EC:3.5.1.60

Alternative names:Acylsphingosine deacylase NAAA By Similarity (EC:3.5.1.23 By Similarity) . EC:3.5.1.23 (UniProtKB | ENZYME | Rhea) By Similarity N-acylsphingosine amidohydrolase-like (ASAH-like protein)

Cleaved into:

GeneID:497009

Gene names  (primary ):Naaa

Gene names  (synonym ):Asahl

Gene names  (ORF ):

Length:362

Mass:40,313

Sequence:MGTPAIRAACHGAHLALALLLLLSLSDPWLWATAPGTPPLFNVSLDAAPELRWLPMLQHYDPDFVRAAVAQVIGDRVPQWILEMIGEIVQKVESFLPQPFTSEIRGICDYLNLSLAEGVLVNLAYEASAFCTSIVAQDSQGRIYHGRNLDYPFGNALRKLTADVQFVKNGQIVFTATTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWLIRKTLTESEDFEAAVYTLAKTPLIADVYYIVGGTSPQEGVVITRDRGGPADIWPLDPLNGAWFRVETNYDHWEPVPKRDDRRTPAIKALNATGQAHLSLETLFQVLSVFPVYNNYTIYTTVMSAAEPDKYMTMIRNPS

Tissue specificity:Expressed in brain, cecum, colon, heart, ileum, kidney, liver, lung, spleen, stomach, submaxillary gland, testis and thymus. 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp