EFHD1_MOUSE Q9D4J1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D4J1
Recommended name：EF-hand domain-containing protein D1
EC number：
Alternative names：(EF-hand domain-containing protein 1) (Mitocalcin) (Swiprosin-2)
Cleaved into：
GeneID：98363
Gene names (primary )：Efhd1
Gene names (synonym )：Sws2
Gene names (ORF )：
Length：240
Mass：27000
Sequence：MSSEELACKLQRRLRLEVRAETDQGDPQPAPCDAPAGHPEPEPPARAPTASADSELNLKLSRRLDIHQGTARPGRSKVFNPYTEFPEFSRRLLKDLEKMFKTYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLLALAKFSEIDVALEGVRGAKNFFEAKAQALSCSSKFEAELKAEQEERKREEEARRLRQAAFRELKAAFSA
Tissue specificity：Widely expressed (PubMed:16336229). Highest expression in testis, followed by ovary, kidney, cerebrum, cerebellum, heart, liver, and spleen (PubMed:12270117). In the cerebrum and cerebellum, undetectable at embryonic stages, expression increases after birth up to adult stage (PubMed:12270117). In adult CNS, detected in neurons of the cerebellum, cerebrum and hippocampus formation, including dentate gyrus and Cornu Ammonis, but not in the white matter (PubMed:12270117). In the testis, expressed in spermatocytes, but not in spermatogonia nor in interstitial cells (PubMed:12270117). In ovary, found predominantly in mural granulosa cells and those of the cumulus oophorus (PubMed:12270117). In kidney, expressed in collecting ducts, but not in glomeruli (PubMed:12270117). Not detected in skeletal muscle (PubMed:12270117). {ECO:0000269|PubMed:12270117, ECO:0000269|PubMed:16336229}.
Induction：
Developmental stage：In the cerebral cortex, at birth, confined in the Purkinje cell layer (PCL) and in cerebellar nuclei. Not detected in the external germinal layer (EGL). At P5 and P10, predominantly found in the PCL and internal germinal layer (IGL). Not detected in the EGL. At P10 and P20, up-regulated. At P20, expression similar to that of the adult cerebellum. {ECO:0000269|PubMed:12270117}.
Protein families：