PGRC1_RAT P70580
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70580
Recommended name:Membrane-associated progesterone receptor component 1
EC number:
Alternative names:25-DX 1 Publication Acidic 25 kDa protein 1 Publication Ventral midline antigen 1 Publication (VEMA 1 Publication)
Cleaved into:
GeneID:291948
Gene names (primary ):Pgrmc1
Gene names (synonym ):25dx, Lewi, Pgrmc
Gene names (ORF ):
Length:195
Mass:21,598
Sequence:MAAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDEAARKSD
Tissue specificity:Expressed at high levels in lung, liver, kidney and brain, low in testis and spleen. Not expressed in heart and skeletal muscle.
Induction:
Developmental stage:By dioxin.
Protein families:cytochrome b5 family