DNS2B_RAT   Q9QZK9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZK9

Recommended name:Deoxyribonuclease-2-beta

EC number:EC:3.1.22.1

Alternative names:DNase II-like acid DNase DNase2-like acid DNase Deoxyribonuclease II beta (DNase II beta) Endonuclease DLAD

Cleaved into:

GeneID:59296

Gene names  (primary ):Dnase2b

Gene names  (synonym ):Dlad

Gene names  (ORF ):

Length:356

Mass:40,472

Sequence:MTAQPLKAALPLLFVALSGVLGTPVISCINEDGKAVDWFAFYKLPRRTSRGGTGMGLDYLYLDSTMRTWSKSHHLINSSRSSLGRTLEQLYEAHNAKNDTAYLIYNDAVPASVNYSGNYGHAKGLLVWNRVQGFWLIHSIPKFPPVPEKGYEYPSSGRQYAQSGLCITLKYSQYETIDSQLLVFQPNIYSCFIPNIFRWELIHMPQMCAKSSASKIPSRRLTVLQSAQGLNFLHFAKSTFYTDDIFAAWIAQKLKVHLLVESWQRKNHELPSNCSLPYHVYNIKAIRGPLQSDFPSHHDHSKWCVSTKDSQARWTCIGDLNRSPHQALRSGGFICSKNRYIYQSFDRLVSHYASCN

Tissue specificity:Liver specific. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp