AWAT2_MOUSE   Q6E1M8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6E1M8

Recommended name:Acyl-CoA wax alcohol acyltransferase 2

EC number:EC 2.3.1.75

Alternative names:(11-cis-specific retinyl-ester synthase) (11-cis-RE-synthase) (Acyl-CoA retinol O-fatty-acyltransferase) (ARAT) (Retinol O-fatty-acyltransferase) (Diacylglycerol O-acyltransferase 2-like protein 4) (Long-chain-alcohol O-fatty-acyltransferase 2) (Wax synthase) (mWS)

Cleaved into:

GeneID:245532

Gene names  (primary ):Awat2

Gene names  (synonym ):Dgat2l4 Ws

Gene names  (ORF ):

Length:333

Mass:38145

Sequence:MFWPTKKDLKTAMEVFALFQWALSALVIVTTVIIVNLYLVVFTSYWPVTVLMLTWLAFDWKTPERGGRRFTCVRKWRLWKHYSDYFPLKMVKTKDISPDRNYILVCHPHGLMAHSCFGHFATDTTGFSKTFPGITPYMLTLGAFFWVPFLRDYVMSTGSCSVSRSSMDFLLTQKGTGNMLVVVVGGLAECRYSTPGSTTLFLKKRQGFVRTALKHGVSLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQKMVHIYPCAFYGRGLTKNSWGLLPYSQPVTTVVGEPLPLPKIENPSEEIVAKYHTLYIDALRKLFDQHKTKFGISETQELVIV

Tissue specificity:Expressed in Mueller cells of the retina (at protein level) (PubMed:24799687). Abundant in tissues rich in sebaceous glands such as the preputial gland and eyelid (PubMed:15220349). {ECO:0000269|PubMed:15220349, ECO:0000269|PubMed:24799687}.

Induction:

Developmental stage:

Protein families:Diacylglycerol acyltransferase family


   💬 WhatsApp