MGN2_MOUSE Q9CQL1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQL1
Recommended name：Protein mago nashi homolog 2
EC number：
Alternative names：
Cleaved into：
GeneID：66441
Gene names (primary )：Magohb
Gene names (synonym )：Magoh-rs1 Magoh2
Gene names (ORF )：
Length：146
Mass：17092
Sequence：MGSDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
Tissue specificity：Ubiquitous. Detected in brain, heart, liver, lung, spleen and testis. {ECO:0000269|PubMed:23917022}.
Induction：In macrophages, strongly induced by bacterial lipopolysaccharide (LPS). Levels reach a maximum 6 hours after exposure to LPS and are lower, but still much increased after 12 and 24 hours. {ECO:0000269|PubMed:23917022}.
Developmental stage：
Protein families：Mago nashi family