OTOSP_RAT Q8K560
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K560
Recommended name:Otospiralin
EC number:
Alternative names:
Cleaved into:
GeneID:246044
Gene names (primary ):Otos
Gene names (synonym ):
Gene names (ORF ):
Length:89
Mass:10,095
Sequence:MQPCVLWWLALGLLLGIPAGAKPTPEEADPNAQPPAMPYWPFSTSDFWNYVQYFQSQGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED
Tissue specificity:Ear specific. Expressed in the cochlea and vestibule, but not in the cochlear nerve, cochlear nucleus, spinal chord, muscle, cerebral cortex, cerebellum, diencephalon and olfactory bulb. In the cochlea, expressed in fibrocytes of the spiral limbus, spiral ligament and suprastrial zone. In the vestibule, expressed in cells located to the stroma below the macular and crista sensory epithelia and in the subepithelial layer of the walls of semicircular canals and maculae. 1
Induction:
Developmental stage:
Protein families: