NKX63_MOUSE Q3UHX8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UHX8
Recommended name:Homeobox protein Nkx-6.3
EC number:
Alternative names:
Cleaved into:
GeneID:74561
Gene names (primary ):Nkx6-3
Gene names (synonym ):
Gene names (ORF ):
Length:262
Mass:28779
Sequence:MESNLQGTFLLNNTQLAQFSEMKAPMCQYSVQNSFYKLSPPGLGPQLAAGTPHGITDILSRPVATPNSSLLSGYPHVAGFGGLSSQGVYYGPQVGSFSKAGNEYPTRTRNCWADTGQDWRGSARPCSNTPDPLSDTIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEPSSSTPRAPGGASGDRAASENEDDEYNKPLDPDSDDEKIRLLLRKHRAAFSVLSLGAHSV
Tissue specificity:Expressed in the developing CNS and gastro-intestinal tract. {ECO:0000269|PubMed:16326147}.
Induction:
Developmental stage:In the developing embryo, it is confined to the gut and caudal hindbrain. In caudal hindbrain, it is specifically expressed in a subpopulation of differentiating V2 neurons. Not detected prior to 12.5 dpc and is not found in motor nuclei. At 12.5 dpc, it is expressed in the ventral medial aspect of the medullary reticular formation (MDR). At 16.5 dpc, expression is confined to the gigantocellular nucleus, a nucleus that is part of the MDR. In addition to the CNS, it is also expressed in the developing gut, in duodenal and glandular stomach endoderm and, at the end of gestation becomes restricted to the base of the gastric units in the glandular stomach. Expressed at very low level in the pancreatic epithelium. Expressed in the pancreas at 15.5 dpc. {ECO:0000269|PubMed:15928328, ECO:0000269|PubMed:16297379, ECO:0000269|PubMed:16326147}.
Protein families: