SERP1_RAT Q9R2C1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R2C1
Recommended name：Stress-associated endoplasmic reticulum protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：80881
Gene names (primary )：Serp1
Gene names (synonym )：Ramp4
Gene names (ORF )：
Length：66
Mass：7,374
Sequence：MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM
Tissue specificity：Detected in astrocytes, brain, lung, liver, kidney, spleen and testis. 1
Induction：
Developmental stage：Up-regulated in cultured astrocytes in response to hypoxia; levels remain elevated for at least 4 hours after return to normoxia. Up-regulated in ischemic brain. 1
Protein families：