FNDC5_MOUSE Q8K4Z2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K4Z2
Recommended name：Fibronectin type III domain-containing protein 5
EC number：
Alternative names：(Fibronectin type III repeat-containing protein 2) (Peroxisomal protein) (PeP)
Cleaved into：Irisin
GeneID：384061
Gene names (primary )：Fndc5
Gene names (synonym )：Frcp2 Pep
Gene names (ORF )：
Length：209
Mass：23321
Sequence：MPPGPCAWPPRAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
Tissue specificity：In adult, it is highly expressed in skeletal muscle, heart and brain. {ECO:0000269|PubMed:12112469, ECO:0000269|PubMed:12384288}.
Induction：Up-regulated by muscular exercise. This effect can be mediated, at least partly, by PPARGC1A. {ECO:0000269|PubMed:22237023}.
Developmental stage：During embryonic development, it is detected almost exclusively in the skeletal muscle, and at lower level in brain. In skeletal muscle, it is induced after myoblast differentiation, when myotube formation is promoted. {ECO:0000269|PubMed:12112469}.
Protein families：