KR151_MOUSE Q9QZU5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZU5
Recommended name：Keratin-associated protein 15-1
EC number：
Alternative names：(Keratin-associated protein 15) (Pubertal mammary gland-specific protein 2)
Cleaved into：
GeneID：26560
Gene names (primary )：Krtap15-1
Gene names (synonym )：Krtap15 Pmg2
Gene names (ORF )：
Length：150
Mass：16242
Sequence：MSYTCNSGNYSSQSFGGFLRQPVSTYNSFYPTSNVVYSPKNFQLGSSFYNGQQETFSEPLEGHLPCVGSASFHTSCFRPKQYFSSPCQGGFTGSFGYGNTGFGAFGFGSSGIRSQGCGSNFYRPGYFSSKSIQSSYYQPGYSSGFCGSNF
Tissue specificity：Expressed at high levels in skin and at lower levels in the developing mammary gland. {ECO:0000269|PubMed:10446281}.
Induction：
Developmental stage：In skin, expression starts shortly after birth and reaches a first maximum at 9 days. A second peak of expression is observed at 3.5 weeks, then levels decline and remain low in the adult. In the developing mammary gland, expression is detected exclusively at the onset of puberty. {ECO:0000269|PubMed:10446281}.
Protein families：PMG family