ST1A1_RAT P17988
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P17988
Recommended name：Sulfotransferase 1A1
EC number：EC:2.8.2.1
Alternative names：ST1A1
Cleaved into：
GeneID：83783
Gene names (primary )：Sult1a1
Gene names (synonym )：St1a1
Gene names (ORF )：
Length：291
Mass：33,906
Sequence：MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Tissue specificity：Liver, kidney, heart and colon. 1
Induction：
Developmental stage：Induced by androgens and suppressed by estrogens. The expression is under the influence of pituitary growth hormone and thyroid hormone.
Protein families：