IKBD_MOUSE Q2TB02
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2TB02
Recommended name：NF-kappa-B inhibitor delta
EC number：
Alternative names：(I-kappa-B-delta) (IkB-delta) (IkappaBdelta) (IkappaBNS)
Cleaved into：
GeneID：243910
Gene names (primary )：Nfkbid
Gene names (synonym )：Ikbns
Gene names (ORF )：
Length：327
Mass：34942
Sequence：MEDSLDTRLYPEPSLSQVGSWRVSSLPSGSPQLPSPTGPSLETARAHILALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQMYRQLDIREHKGKTPLLVAAAANQPLIVEDLLSLGAEPNATDHQGRSVLHVAATYGLPGVLSAVFKSGIQVDLEARDFEGLTPLHTAVLALNAAMLPASVCPRMQNSQARDRLTCVQMLLQMGASHTSQEIKSNKTILHLAVQAANPTLVQLLLGLPRGDLRAFVNMKAHGNTALHMAAALPPGPPQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRTAPPGLSS
Tissue specificity：Specifically expressed in spleen and at low levels in thymus. Expressed in a population of antigen-presenting dendritic cells which may act as regulators of systemic inflammatory response. {ECO:0000269|PubMed:11931770, ECO:0000269|PubMed:16410444}.
Induction：Up-regulated in thymocytes upon TCR-triggered cell death (at protein level). Up-regulated by IL-10 or LPS. {ECO:0000269|PubMed:11931770, ECO:0000269|PubMed:15749903}.
Developmental stage：
Protein families：NF-kappa-B inhibitor family