I23O2_RAT F1LV46
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:F1LV46
Recommended name:Indoleamine 2,3-dioxygenase 2 By Similarity
EC number:EC:1.13.11.-
Alternative names:IDO-2
Cleaved into:
GeneID:681319
Gene names (primary ):Ido2
Gene names (synonym ):Indol1
Gene names (ORF ):
Length:405
Mass:45,236
Sequence:MEAQRQDGKLASSLSLGKYHISEEYGFLLPNPLEELPDHYKPWMEIAHRLPHLIESHQLQAHVYEMPLLDCRFLTSYREQRLAHLVLAAITMGFVWQEGEAQPQKVLPRTLAIPFVEVSRSLGLPPILVHSDLVLTNWTKRNPEGPLEIGNLETIISFPGGESLQGFILVTVLVEKAAVPGIKALVLGVEAIRQHSQDTLLEALQQLRLSIQDITRALAQMHDYVDPEIFYLVIRIFLSGWKDNPVMPVGLVYEGVSTEPLKYSGGSAAQSSVLHAFDEFLGIQHCKESVDFLHRMRDYMPPSHKAFLEDLHSAPSLRDYILDSGPGGCLMAYNQCVEALGELRSYHINMVARYIISAASKARSRMLTRLSPHALEDRGTGGTAVLSFLKSVREKTMEAILCPGA
Tissue specificity:
Induction:
Developmental stage:
Protein families: