CYAC3_MOUSE Q6P1H1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6P1H1
Recommended name:Cytochrome b ascorbate-dependent protein 3
EC number:EC 1.-.-.-
Alternative names:(Cytochrome b561 family member A3) (Lysosomal cytochrome b) (LCytb)
Cleaved into:
GeneID:225912
Gene names (primary ):Cyb561a3
Gene names (synonym ):Cybasc3 Lcytb
Gene names (ORF ):
Length:242
Mass:27086
Sequence:MASGWFYLSCMVLGSLGSMCILFTAYWMQYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYGAASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWLGITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLHVFFGACILSLSITSVISGINEKLFFVLKNATKPYSSLPGEAVFANSTGLLVVAFGLLVLYVLLASSWKRPDPGALTDRQPLLHDRE
Tissue specificity:Present in lung, spleen, thymus and testis. Present at low level in brain, heart, liver and kidney. Expressed in the alveolar macrophages of the lung, in the white pulp of the spleen, widespread in the thymus, and in the Sertoli cells of the testis (at protein level). {ECO:0000269|PubMed:16996694}.
Induction:
Developmental stage:At 17.5 dpc, it is primarily expressed in lung, spleen, thymus, testis, placenta, small intestine and stomach. {ECO:0000269|PubMed:16996694}.
Protein families: