ST2B1_MOUSE   O35400


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35400

Recommended name:Sulfotransferase 2B1

EC number:EC 2.8.2.2

Alternative names:(Alcohol sulfotransferase) (Hydroxysteroid sulfotransferase 2) (Sulfotransferase family cytosolic 2B member 1) (ST2B1)

Cleaved into:

GeneID:54200

Gene names  (primary ):Sult2b1

Gene names  (synonym ):Sult2b

Gene names  (ORF ):

Length:338

Mass:38347

Sequence:MDGPQPRALWSSSEKNVSEMSWNFGGEYFRYKGIPFPVGMYSPESLSLAENTSNVRDDDIFIVTYPKSGTNWMIEIVCLILKDGDPSWIRSEPIWQRAPWCETIISAFNVLDRPSPRIMSSHLPIELFTKAFFSSKAKVIYVGRNPRDVVVSLYYYSKIAGQLKDPGTPDQFLQNFLKGEVQFGSWFDHIKGWIRMQNQENFLFITYEELQQDLRGSVQRICEFLGRPLGEEALSSVVAHSAFAAMKANTMSNYSLLPASLLDHRQGEFLRKGISGDWKNHFTVAQSEAFDSVYREQMHGVQRFPWDTSEEDSSPDGQPDPEPSPSPASDDPNPGSSQ

Tissue specificity:Expressed at high levels in epididymis, intestine and uterus, and low levels in brain and hypothalamus (PubMed:9647753). Isoform 2 is most prominent in the brain and spinal cord, with modest expression in the lung, skin and spleen (PubMed:12639899). Isoform 1 is most prominently expressed in skin and small intestine, with modest expression in muscle and prostate (PubMed:12639899). {ECO:0000269|PubMed:12639899, ECO:0000269|PubMed:9647753}.

Induction:

Developmental stage:Isoform 1 and isoform 2 are expressed from stages 8.5-19 dpc. {ECO:0000269|PubMed:12639899}.

Protein families:Sulfotransferase 1 family


   💬 WhatsApp