GA45A_MOUSE P48316
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P48316
Recommended name：Growth arrest and DNA damage-inducible protein GADD45 alpha
EC number：
Alternative names：(DNA damage-inducible transcript 1 protein) (DDIT-1)
Cleaved into：
GeneID：13197
Gene names (primary )：Gadd45a
Gene names (synonym )：Ddit1 Gadd45
Gene names (ORF )：
Length：165
Mass：18339
Sequence：MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDAGPAESGGAAQTPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Tissue specificity：
Induction：By various types of DNA damage and growth arrest.
Developmental stage：
Protein families：GADD45 family