NUDT5_RAT   Q6AY63


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6AY63

Recommended name:ADP-sugar pyrophosphatase By Similarity

EC number:EC:3.6.1.13

Alternative names:8-oxo-dGDP phosphatase By Similarity (EC:3.6.1.58 By Similarity) . EC:3.6.1.58 (UniProtKB | ENZYME | Rhea) By Similarity Nuclear ATP-synthesis protein NUDIX5 By Similarity (EC:2.7.7.96 By Similarity) . EC:2.7.7.96 (UniProtKB | ENZYME | Rhea) By Similarity Nucleoside diphosphate-linked moiety X motif 5 Curated (Nudix motif 5 Curated)

Cleaved into:

GeneID:361274

Gene names  (primary ):Nudt5

Gene names  (synonym ):

Gene names  (ORF ):

Length:219

Mass:24,117

Sequence:METQEPKDSSPPTEQRILSEELISEGKWVKFEKTTYMDPTGKTRTWETVKLTTRKGKSADAVSVIPVLQRTLHHECIVLVKQFRPPMGGYCLEFPAGLIEDGESPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTTHVVTVTINGDDAGNVRPKPKPGDGEFVEVISLPKNDLLTRLDALGAEDRLTVDARVYAYALALKHANAKPFEVPFLKF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp