SCAM5_MOUSE   Q9JKD3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JKD3

Recommended name:Secretory carrier-associated membrane protein 5

EC number:

Alternative names:(Secretory carrier membrane protein 5)

Cleaved into:

GeneID:56807

Gene names  (primary ):Scamp5

Gene names  (synonym ):

Gene names  (ORF ):

Length:235

Mass:26068

Sequence:MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVVAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM

Tissue specificity:Brain-specific. {ECO:0000269|PubMed:11050114}.

Induction:

Developmental stage:Expressed late in development coincident with the elaboration of mature synapses.

Protein families:SCAMP family, SCAMP5 subfamily


   💬 WhatsApp