MRP_MOUSE P28667
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P28667
Recommended name：MARCKS-related protein
EC number：
Alternative names：(Brain protein F52) (MARCKS-like protein 1) (Macrophage myristoylated alanine-rich C kinase substrate) (Mac-MARCKS) (MacMARCKS)
Cleaved into：
GeneID：17357
Gene names (primary )：Marcksl1
Gene names (synonym )：Mlp Mrp
Gene names (ORF )：
Length：200
Mass：20165
Sequence：MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVRSNGDLTPKGEGESPPVNGTDEAAGATGDAIEPAPPSQEAEAKGEVAPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEMSACSDEGTAQEGKAAATPESQEPQAKGAEASAASKEGDTEEEAGPQAAEPSTPSGPESGPTPASAEQNE
Tissue specificity：Expressed at high levels in brain cortex and hippocampus, including dentate gyrus, anterior olfactory nucleus, primary olfactory cortex, entorhinal cortex, medial preoptic area and dorsomedial hypothalamic nucleus (at protein level) (PubMed:1864362, PubMed:8406449, PubMed:9598313, PubMed:22751924). Expressed in neuronal cells (at protein level) (PubMed:22751924). Detected in the retina (PubMed:9598313). Strongly expressed in testis and uterus; expressed at lower levels in cerebellum, cerebrum, adipose tissue, spleen, kidney, thyroid, liver, lung, skeletal muscle and heart (PubMed:8406449). Detected in T-cells and B-cells (PubMed:8406449). {ECO:0000269|PubMed:1864362, ECO:0000269|PubMed:22751924, ECO:0000269|PubMed:8406449, ECO:0000269|PubMed:9598313}.
Induction：Up-regulated in peritoneal macrophages in response to bacterial lipopolysaccharide (LPS). {ECO:0000269|PubMed:1516135}.
Developmental stage：Expressed in the developing neural tube as early as 8.5 dpc. Remains most highly expressed in the developing brain and spinal cord during later development at least until 14.5 dpc. Also detected in the lung, adrenal gland, gut and kidney, particularly the kidney cortex. Undetectable in the liver. {ECO:0000269|PubMed:9598313}.
Protein families：MARCKS family