SPIN1_MOUSE Q61142
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61142
Recommended name：Spindlin-1
EC number：
Alternative names：(30000 Mr metaphase complex) (SSEC P) (Spindlin1)
Cleaved into：
GeneID：20729
Gene names (primary )：Spin1
Gene names (synonym )：Spin
Gene names (ORF )：
Length：262
Mass：29643
Sequence：MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
Tissue specificity：Oocyte, egg, and very early embryo; not in the 8-, and 16-cell stage of the embryo. Isoform 1: Present in testis. Isoform 1 is more highly expressed in adult testes compared with newborn testes (at protein level). {ECO:0000269|PubMed:9053325}.
Induction：
Developmental stage：Gametogenesis. Synthesized from maternal transcripts but not from the zygote genome. {ECO:0000269|PubMed:9053325}.
Protein families：SPIN/STSY family