NIPA2_MOUSE Q9JJC8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJC8
Recommended name:Magnesium transporter NIPA2
EC number:
Alternative names:(Non-imprinted in Prader-Willi/Angelman syndrome region protein 2 homolog)
Cleaved into:
GeneID:93790
Gene names (primary ):Nipa2
Gene names (synonym ):
Gene names (ORF ):MNCb-2146
Length:359
Mass:39091
Sequence:MSLGRGKYDFYIGLGLAMTSSIFIGGSFILKKKGLLRLARKGSMRAGQGGHAYLKEWLWWAGLLSMGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATFVVIVALIFIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELLAGKPVLQHPLAWILLFSLVVCVSTQINYLNRALDIFNTSIVTPIYYVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFKDVSFSLASLPVSFRKDEKAMNGNLSSMYEVLNNNEDDLPCGIEHTGENISRRNGNLPSF
Tissue specificity:Widely expressed. Expressed at high levels in the kidney. {ECO:0000269|PubMed:14508708, ECO:0000269|PubMed:18667602}.
Induction:Up-regulated by low magnesium ion levels. {ECO:0000269|PubMed:18667602}.
Developmental stage:
Protein families:NIPA family