I70A2_RAT   Q4QQS2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4QQS2

Recommended name:Intraflagellar transport protein 70A2

EC number:

Alternative names:

Cleaved into:

GeneID:311123

Gene names  (primary ):Ift70a2

Gene names  (synonym ):Ttc30a1 Imported, Ttc30a2

Gene names  (ORF ):

Length:664

Mass:76,065

Sequence:MAGLSSSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSPRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPSFYSRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFFAALQASGYQPDVSYNLALACYSNRHYAPALKHIANIIERGIRQHPELGVGMTTEGIDVRSVGNTVVLHQTALVEAFNLKAAIEYQLRNFEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEVVIKAVNEYDETLEKYIPVLMAQAKIYWNLENYQMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCEIFGRSIPAVIEQPLEEERMHTGKNTVTYESRQLKALIYEIIGWNM

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp